PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM12G08360.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 944aa    MW: 102937 Da    PI: 4.7368
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM12G08360.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.84.6e-175198148
                     TSSS-HH.HHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTte.EdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+e Ed+++v+ v++lG++ W+tIa+ ++ gR +kqc++rw+++l
  OGLUM12G08360.1 51 KGNWTPEeEDDIIVQMVNKLGPKKWSTIAQALP-GRIGKQCRERWHNHL 98
                     799**8725789*********************.*************97 PP

2Myb_DNA-binding47.34.8e-15104146145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + +WT+eE+  l++a++++G++ W+   + ++ gRt++ +k++w+
  OGLUM12G08360.1 104 KEAWTQEEEITLIHAHRMYGNK-WAELTKFLP-GRTDNAIKNHWN 146
                      579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.99446102IPR017930Myb domain
SuperFamilySSF466897.86E-2849145IPR009057Homeodomain-like
SMARTSM007173.6E-1450100IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.9E-2452106IPR009057Homeodomain-like
CDDcd001679.31E-145398No hitNo description
PfamPF139212.4E-1554115No hitNo description
PROSITE profilePS5129419.654103153IPR017930Myb domain
SMARTSM007174.4E-14103151IPR001005SANT/Myb domain
CDDcd001676.63E-11106146No hitNo description
Gene3DG3DSA:1.10.10.606.2E-21107153IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 944 aa     Download sequence    Send to blast
MMTSDNGKAP EKGGEASGPS SAPQEGEISN EPQRRRPLSG RTTGPTRRST KGNWTPEEED  60
DIIVQMVNKL GPKKWSTIAQ ALPGRIGKQC RERWHNHLNP GINKEAWTQE EEITLIHAHR  120
MYGNKWAELT KFLPGRTDNA IKNHWNSSVK KKVDSYMSSG LLTQVSCLPL NEYSAHCNSS  180
PALTQQNSED SGSYAVREVE NSSVCSQSSL AKVSCSQVHN ANVALGCDLQ VNANVDNNEA  240
HDSQSSVGHE ACYTSVGAVA TAIPEVHYHV SSSNFDPDQH LQEEFAQGLN LHMSMDEVPS  300
NSSFADNPTI CSIENHERSL EPYDVAMEMP LSMLPSDSGA EQKLHFMSEA DFNSPNCLKS  360
ELWQDISLQS LLSGPDAVET DSFSRSNHQS DVYSSQADNE FLAPPYLLQT SNSSSVMEAT  420
YGQSPQMSVP PSLICSNVMT DVPSDNRSEP KEMTVSQAEM VTQSSSSSGD AEMSANPGSS  480
NGSDIPSMME RVPECADQHV TNAEEPEASI EKEPSVTPSA TADEKQDEGA LFYEPPRFPS  540
MDVPFVSCDL VTSGDLQEYS PLGIRQLMRS TMNVCTPMRL WGSPTHDESP DILLKSAAKS  600
FICTPSILKK RHRDLVSPIP DKRIEKKSGT EKDCGVSDTS SIGIQTCFIN ATKDDAVITK  660
SVLRIERSAS SKPLEKKLEF SDENKENLDN TIEQAKDGQS AGNDKHIDEQ ARGERRTATN  720
ITTTYDDLPG NLQPAGILIE HNGDDLVSPD YGKNTMKQKQ NTNMESLSVC KEGVSAKKPA  780
ELIVEKSSAC INVDYEYVNI LADTPGIKRG LESPSAWKSP WFVDMQFQGS YFVSPANGSY  840
DALGLVKQIN VQTAAALAEA REVLASGGQS ENINSDKENL ENPDAKKEPG ATTKLQAKIK  900
TEGKILDFNE CATPIRSSDK KAGSSLGRSL SSPIPSSHLL KSFR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C8e-43511534105C-Myb DNA-Binding Domain
1msf_C8e-43511534105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4300510.0AJ430051.1 Oryza sativa mRNA for transcription factor myb (myb3R1 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006663924.20.0PREDICTED: myb-related protein 3R-1-like isoform X2
TrEMBLA0A0E0BQT60.0A0A0E0BQT6_9ORYZ; Uncharacterized protein
STRINGBGIOSGA036408-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24953879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.11e-56Homeodomain-like protein